PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c7_23490V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 422aa    MW: 46338.6 Da    PI: 6.5056
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c7_23490V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.26.9e-171764148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                       +g+WT++Ed +lv +++++G g+W++ ++  g+ R++k+c++rw +yl
  Pp3c7_23490V3.2.p 17 KGPWTPDEDRKLVAYIQEHGHGSWRALPKNAGLMRCGKSCRLRWTNYL 64
                       79********************************************97 PP

2Myb_DNA-binding57.82.5e-1870115148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgr+++ Ed+ +v+++  lG++ W+tIa++++ gRt++++k++w++yl
  Pp3c7_23490V3.2.p  70 RGRFSEAEDQMIVHLHSILGNR-WSTIAAHLP-GRTDNEIKNYWNTYL 115
                        89********************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.141264IPR017930Myb domain
SuperFamilySSF466891.87E-3014111IPR009057Homeodomain-like
SMARTSM007175.4E-131666IPR001005SANT/Myb domain
PfamPF002491.4E-151764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-231871IPR009057Homeodomain-like
CDDcd001679.93E-121964No hitNo description
PROSITE profilePS5129427.5465119IPR017930Myb domain
SMARTSM007172.2E-1769117IPR001005SANT/Myb domain
PfamPF002494.8E-1670115IPR001005SANT/Myb domain
CDDcd001676.85E-1372115No hitNo description
Gene3DG3DSA:1.10.10.605.4E-2772119IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 422 aa     Download sequence    Send to blast
MGRAPGNCDE KEAGLRKGPW TPDEDRKLVA YIQEHGHGSW RALPKNAGLM RCGKSCRLRW  60
TNYLRPDIKR GRFSEAEDQM IVHLHSILGN RWSTIAAHLP GRTDNEIKNY WNTYLKKRLL  120
QLGIDPVTHK ECSTADLVLE GADMNPLVSS TLSHMSQWDR VRMETEARLT SATSFSKSAV  180
AGGIIHPRSS FSDLEAVLQR VLGSDTFMGP WKSQVATDSA SQPIPGAASQ AVFADLQNVF  240
QGLEASSPSS ASFESLYSAC ANQLAESSSM NSHGSGHDDY HSPVSSTITS SKLLNPMSPT  300
SILSPLSNSS DILWDCNQDT SFWQTQQVNG LLMDSSTQTL PEASSHNYDQ DQLIGEPNLD  360
ARYGDSSTRE STLRYLLPEN CHSFYNLDFP QYLLQTNCKS TAAQILSAAP HIIGNPVSGR  420
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29151195108B-MYB
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S2_55V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.13e-77myb domain protein 16